PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pavir.1KG047300.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family HD-ZIP
Protein Properties Length: 240aa    MW: 25216.2 Da    PI: 10.7566
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pavir.1KG047300.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox56.93.6e-18125179256
                          T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
             Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                          rk+ ++++ q   Le+ F+ ++ +s+ e++eLA+++gL+ rqV vWFqNrRa+ k
  Pavir.1KG047300.1.p 125 RKKLRLNAAQAAMLEDSFRAHNILSHGEKQELARRVGLSARQVEVWFQNRRARTK 179
                          67788999*********************************************98 PP

2HD-ZIP_I/II111.55.5e-36125213189
          HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLre 89 
                          +kk+rl++ q+++LE+sF++++ L++ +K+elar++gl++rqv+vWFqnrRARtk+kq+E+d+e L+r++d+l++en+rL+++ + Lr+
  Pavir.1KG047300.1.p 125 RKKLRLNAAQAAMLEDSFRAHNILSHGEKQELARRVGLSARQVEVWFQNRRARTKLKQTEVDCELLRRWCDRLTDENARLRRDLAGLRA 213
                          69**********************************************************************************99986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007116.763121181IPR001356Homeobox domain
SMARTSM003899.1E-14123185IPR001356Homeobox domain
SuperFamilySSF466899.19E-18124190IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.606.0E-17125179IPR009057Homeodomain-like
PfamPF000461.4E-15125179IPR001356Homeobox domain
CDDcd000864.93E-12125182No hitNo description
PRINTSPR000312.1E-6152161IPR000047Helix-turn-helix motif
PROSITE patternPS000270156179IPR017970Homeobox, conserved site
PRINTSPR000312.1E-6161177IPR000047Helix-turn-helix motif
PfamPF021838.0E-8181213IPR003106Leucine zipper, homeobox-associated
SMARTSM003405.8E-14181224IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 240 aa     Download sequence    Send to blast
MSSLTTAGSA EERHYSVSAE EFGTHLSLGI GGGPGGGGGG GRPRPRTVQL FGEVLSLEGD  60
NNGEPTAAPS GRKRRDRSGS GAAAVPASRQ QNKKARKVKD ADDDGDRRSL TSGGGGGGGG  120
SGAGRKKLRL NAAQAAMLED SFRAHNILSH GEKQELARRV GLSARQVEVW FQNRRARTKL  180
KQTEVDCELL RRWCDRLTDE NARLRRDLAG LRAAPARLAV CASCCDKKAQ VAVAAGEMA*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1173181RRARTKLKQ
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Pvr.147246e-35root
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFP0932885e-32FP093288.1 Phyllostachys edulis cDNA clone: bphylf053m07, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004951890.11e-91PREDICTED: putative homeobox-leucine zipper protein HOX26
SwissprotQ67UX69e-55HOX26_ORYSJ; Putative homeobox-leucine zipper protein HOX26
TrEMBLK3YVK92e-91K3YVK9_SETIT; Uncharacterized protein
STRINGSi018305m5e-91(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP83153249
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G16780.15e-30homeobox protein 2